PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G18870.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 268aa    MW: 29839.8 Da    PI: 6.3167
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G18870.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-3256110155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQkYRl
  OPUNC05G18870.2  56 KQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 110
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.74253113IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-3154111IPR009057Homeodomain-like
SuperFamilySSF466891.08E-1655110IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2556111IPR006447Myb domain, plants
PfamPF002492.8E-758109IPR001005SANT/Myb domain
PfamPF143792.4E-24142188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MPEHELGLFI LMMYHAKKFS VPFGPQSTQS SELMNNIGAF GGSNMGSPAN PAGSGKQRLR  60
WTSDLHNRFV DAIAQLGGPD RATPKGVLTV MGVPGITIYH VKSHLQKYRL AKYIPESPAE  120
GSKDEKKDSS DSLSNTDSAP GMQINEALKM QMEVQKRLHE QLEVQRQLQL RIEAQGKYLQ  180
MIIEEQQKLG GSLKACEEQK LPHSPPSLDD YPDSMQPSPK KPKMDNLSPD SVRDVRESDF  240
ESHLIGPWDQ EAAFQVDEFK PDPGLNKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0619870.0AK061987.1 Oryza sativa Japonica Group cDNA clone:001-043-B07, full insert sequence.
GenBankAK0693060.0AK069306.1 Oryza sativa Japonica Group cDNA clone:J023012H08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639152.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015639153.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015639154.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015639155.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN51e-49PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0E0L4580.0A0A0E0L458_ORYPU; Uncharacterized protein
STRINGLOC_Os05g41240.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79133343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-55G2-like family protein